PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015876937.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 364aa    MW: 38523.6 Da    PI: 8.9029
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015876937.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.38e-3985145262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +e++lkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  XP_015876937.1  85 PEASLKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 145
                     67889*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3169134IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3288143IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54489143IPR003851Zinc finger, Dof-type
PROSITE patternPS01361091127IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MVFSSVPVYL DPPNWQQQSN HQQQQGGGRG GVGGDHHQHH QNHHQNPQLP PQPPPPSAGG  60
GGGSQGSIRP GSMSDRARLA KIPQPEASLK CPRCESTNTK FCYFNNYSLT QPRHFCKTCR  120
RYWTRGGALR NVPVGGGCRR NKRSKGSRSK SPATERQTTG GSCSTTTVSS NSCTSDMIAH  180
LSPVVPPPHL PFLPSLHHLS EYGSAGGDIG MNFAGIQPQV VSTGGNDVQY QIGGGGGAAG  240
GSILSSGLAE QWRLQQQVQQ FPFLTNLETP TGLYPFEGEN VEPPSYVGGA GQLRSKPLGS  300
SAVTDGATHQ QQLGGGGAVK MEENQGLNLS RNFLGALGND QYWAGGNAWT DLSGFTSSST  360
SHLL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015876936.10.0PREDICTED: dof zinc finger protein DOF3.6-like
RefseqXP_015876937.10.0PREDICTED: dof zinc finger protein DOF3.6-like
TrEMBLA5BZE71e-140A5BZE7_VITVI; Putative uncharacterized protein
STRINGVIT_13s0019g01410.t011e-127(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.15e-38DNA binding with one finger 2.4